Annexin IV anticorps (Middle Region)

N° du produit ABIN634614

Cet anticorps anti-Annexin IV est un anticorps Lapin Polyclonal détectant Annexin IV dans WB. Adapté pour Chemical.

Aperçu rapide pour Annexin IV anticorps (Middle Region) (ABIN634614)

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin IV est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Annexin IV anticorps

Épitope: Middle Region

Specificité: Annexin A4 antibody was raised against the middle region of ANXA4

Réactivité croisée: Humain

Purification: Affinity purified

Immunogène: Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A4 Blocking Peptide, (ABIN937807), is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin IV

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Autre désignation: Annexin A4

Classe de substances: Chemical

Sujet: Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.

Poids moléculaire: 36 kDa (MW of target protein)